PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638895.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 266aa    MW: 30043.3 Da    PI: 4.8597
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638895.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT eEd++lv +++++G g+W+  +r+ g+ R++k+c++rw++yl
   XP_013638895.1 14 RGGWTDEEDQKLVAYINEYGIGDWRFLPRKAGLQRCGKSCRLRWLNYL 61
                     789*******************************************97 PP

2Myb_DNA-binding55.31.5e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g++T+eE+e +++    lG++ W++Ia+ m+ gR+++++k++w++ 
   XP_013638895.1  67 KGKFTPEEEEAIINFQSILGNR-WAAIAQQMP-GRSDNDIKNHWNSC 111
                      79********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.546961IPR017930Myb domain
SuperFamilySSF466897.34E-3012108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-231668IPR009057Homeodomain-like
CDDcd001671.44E-101761No hitNo description
PROSITE profilePS5129425.87362116IPR017930Myb domain
SMARTSM007178.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2569116IPR009057Homeodomain-like
CDDcd001677.49E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRATWFDAD GTKRGGWTDE EDQKLVAYIN EYGIGDWRFL PRKAGLQRCG KSCRLRWLNY  60
LRPGVKKGKF TPEEEEAIIN FQSILGNRWA AIAQQMPGRS DNDIKNHWNS CLKKRLERNG  120
IDQMTHQPII NLAVKIPSFN IDCGNSSSST VSPSPSFSSS GSASLLNRLA TGISSREHGV  180
DRIKNILSDP RTPIITSQEE EFEESNKDHG KALAGDDQED DFLMWDEENM RRFMDEIGQM  240
DFETNGVYNS SSSSPYSVYE TGLLDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638895.10.0PREDICTED: transcription repressor MYB6-like isoform X1
SwissprotO643991e-56MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A0D3CBB70.0A0A0D3CBB7_BRAOL; Uncharacterized protein
STRINGBra025681.1-P1e-127(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.11e-88myb domain protein 47